DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar8b

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001010837.1 Gene:Taar8b / 382348 MGIID:2685995 Length:344 Species:Mus musculus


Alignment Length:313 Identity:105/313 - (33%)
Similarity:162/313 - (51%) Gaps:28/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGS 177
            :.||..:.|:.||:||::||:..::|....|:.:.|||.||.||.:..|.|:....|...|.||.
Mouse    37 VFGFGAVLAVCGNLLVVISVLHFKQLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGD 101

  Fly   178 VMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLP 242
            ..|.:.:..||.|..:|.:|||.||||||.|:..||.||...|.....|.:.:.|:.|.:.|...
Mouse   102 AFCSLHSCCDVAFCYSSALHLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAV 166

  Fly   243 ICSGWYTTTENYKYLKSNPHI---CEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQER 304
            ..:|  .:.:..:.|.|..:.   |:..||:.:.:: ..:.|:||.:||:.:|.:|:..|.:|  
Mouse   167 FYTG--ISAKGIESLVSALNCVGGCQIVVNQDWVLI-DFLLFFIPTLVMIILYSKIFLVAKQQ-- 226

  Fly   305 LVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLW 369
                    |:.:|     :.:...|.....|.......:||||||:|||:.:.||::.|||    
Mouse   227 --------AVKIE-----TSVSDNRGESSSESHKARVAKRERKAAKTLGVTVVAFMVSWLP---- 274

  Fly   370 YIVSSLCDS---CITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419
            |.:.||.|:   .|||..:..|..|..|:|||:||:|||:|...||.|.|..|
Mouse   275 YTIDSLVDAFVGFITPAYVYEICCWSAYYNSAMNPLIYAFFYPWFRKAIKLIL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 45/117 (38%)
7tm_1 124..404 CDD:278431 93/285 (33%)
Taar8bNP_001010837.1 7tm_4 42..327 CDD:304433 102/306 (33%)
7tm_1 48..312 CDD:278431 93/285 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.