DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar8b

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_006227781.1 Gene:Taar8b / 319106 RGDID:631386 Length:359 Species:Rattus norvegicus


Alignment Length:326 Identity:111/326 - (34%)
Similarity:173/326 - (53%) Gaps:35/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGS 177
            :.||..:.|:.||:||::||:..::|....|:.:.|||.||.||.:..|.|:....|...|.||.
  Rat    52 VFGFGAVLAVCGNLLVVISVLHFKQLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGD 116

  Fly   178 VMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLP 242
            ..|.:.:..|..|..:|:.|||.||||||.|:.:||.||...|.....|.:.:.|:.|.:.|...
  Rat   117 TFCSLHSCCDAAFCYSSLFHLCFISVDRYIAVTEPLVYPTKFTMSVSGICISISWILPLVYSSAV 181

  Fly   243 ICSGWYTT-TENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLV 306
            ..:|...| .||.....:....|:..:|:.:.:: |.:.|:||.:||:.:|.:|:..|.:|    
  Rat   182 FYTGISATGIENLVSALNCVGGCQVAINQDWVLI-SFLLFFIPTLVMIILYSKIFLVAKQQ---- 241

  Fly   307 YRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLWYI 371
                  |:.:|..:..|   |...|::..::.::  :||||||:|||:.:.||::.|||    |.
  Rat   242 ------AVKIETSISGS---KGESSLESHKARVA--KRERKAAKTLGVTVMAFMVSWLP----YT 291

  Fly   372 VSSLCDS---CITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK-----KTLK------SL 422
            :.:|.|:   .|||..:..|..||.|:|||:||:|||:|...||.|.|     |.||      ||
  Rat   292 IDTLIDAFMGFITPAYVYEICGWIAYYNSAMNPLIYAFFYPWFRKAIKLILSGKILKGHSSTTSL 356

  Fly   423 F 423
            |
  Rat   357 F 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 44/117 (38%)
7tm_1 124..404 CDD:278431 94/283 (33%)
Taar8bXP_006227781.1 7tm_4 57..342 CDD:304433 103/304 (34%)
7tm_1 63..327 CDD:278431 94/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.