DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and TAAR6

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_778237.1 Gene:TAAR6 / 319100 HGNCID:20978 Length:345 Species:Homo sapiens


Alignment Length:372 Identity:116/372 - (31%)
Similarity:177/372 - (47%) Gaps:71/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VGSGSSIAVSVEDVVA---GQAQDIQASEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLV 128
            :.|.||:.|:|:...|   |....|..|.||.         .::::   :.||..:.|:.||:||
Human     1 MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSR---------VILYI---VFGFGAVLAVFGNLLV 53

  Fly   129 IVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTA 193
            ::|::..::|...||:.|.|||.||.||.:..|.|:....:...|.||...|......||.|..:
Human    54 MISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYS 118

  Fly   194 SIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLK 258
            |:.|||.||:|||.|:..||.||...|.....|.:.:.|:.|.:.|.....:|.|  .:..:.|.
Human   119 SLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVY--DDGLEELS 181

  Fly   259 SNPHI---CEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLV-------------Y 307
            ...:.   |:..||:.: :::..:||:||..:|:.:|..|:..|.||.:.:             |
Human   182 DALNCIGGCQTVVNQNW-VLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESY 245

  Fly   308 RSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLWYIV 372
            :::||                              |||||||:|||:.:.||:|.|||    |.:
Human   246 KARVA------------------------------RRERKAAKTLGVTVVAFMISWLP----YSI 276

  Fly   373 SSLCDS---CITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK 416
            .||.|:   .|||..:..|..|..|:|||:||:|||.|...||.|.|
Human   277 DSLIDAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 44/118 (37%)
7tm_1 124..404 CDD:278431 94/298 (32%)
TAAR6NP_778237.1 7tm_4 43..>271 CDD:304433 77/260 (30%)
7tm_1 49..311 CDD:278431 94/298 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.