DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar7e

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_783180.2 Gene:Taar7e / 294133 RGDID:631394 Length:358 Species:Rattus norvegicus


Alignment Length:339 Identity:112/339 - (33%)
Similarity:170/339 - (50%) Gaps:61/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGS 177
            :.||..:.|:.||:||:.|::..|:|....|:.|.|||.||:||.|..|.|:....:.|.|.||.
  Rat    53 VFGFSAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGD 117

  Fly   178 VMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLP 242
            :.|...:||||.|...|:.|||.||||||.|:..||.||...|.......:...|....:.||..
  Rat   118 IYCKFHSSFDVSFCYCSLFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWFLSIIYSFSL 182

  Fly   243 ICSGWYTTTENYKYLKSNPHI---CEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIY----QEAD 300
            :.:|  .:....:.|.|....   |:..||:::..: :.:.|.:|.:||:::|.:::    |:|.
  Rat   183 LYTG--ASEAGLEDLVSALTCVGGCQLAVNQSWVFI-NFLLFLVPTLVMMTVYSKVFLIAKQQAQ 244

  Fly   301 RQERL---------VYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIM 356
            ..|::         .|:.:||                              :||||||:||||.:
  Rat   245 NIEKIGKQTARASESYKDRVA------------------------------KRERKAAKTLGITV 279

  Fly   357 SAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK----- 416
            :|||:.|||:|:..|:.:.. ..|||..:..||.||.|:|||:||:|||:|...||.|.|     
  Rat   280 AAFLLSWLPYFIDSIIDAFL-GFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTG 343

  Fly   417 KTLK------SLFP 424
            |.|:      :|||
  Rat   344 KILRENSSATNLFP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 48/117 (41%)
7tm_1 124..404 CDD:278431 96/295 (33%)
Taar7eNP_783180.2 7tm_GPCRs 49..337 CDD:421689 105/317 (33%)
TM helix 1 49..75 CDD:410628 8/21 (38%)
TM helix 2 82..108 CDD:410628 12/25 (48%)
TM helix 3 120..150 CDD:410628 17/29 (59%)
TM helix 4 162..185 CDD:410628 3/22 (14%)
TM helix 5 209..238 CDD:410628 7/29 (24%)
TM helix 6 266..296 CDD:410628 18/29 (62%)
TM helix 7 305..330 CDD:410628 13/24 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.