DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar7a

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_783175.1 Gene:Taar7a / 294125 RGDID:631387 Length:358 Species:Rattus norvegicus


Alignment Length:388 Identity:124/388 - (31%)
Similarity:193/388 - (49%) Gaps:51/388 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DGLIDEGLGSAVGSGSSIAVSVEDVVAGQAQDI--QASEGSTDDADGSSHLALVFVKCFIIGFII 118
            |.|:|..|     ||.|..:| ||:::..:..:  :...||...:..|....|:....|  ||..
  Rat     2 DKLVDNFL-----SGQSRTMS-EDLLSASSPQLCYENLNGSCIRSPYSPGPRLILYAVF--GFGA 58

  Fly   119 LAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMW 183
            :.|:.||:||:.|::..|:|....|:.|.|||.||.||.|..|.|:....:.|.|.||...|...
  Rat    59 VLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGDTYCKFH 123

  Fly   184 NSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWY 248
            :.|:..|..:||.|||.||||||.|:..||.||...|.......:...||...:.||..:.:|  
  Rat   124 SCFEGSFCYSSIFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSFSLLYTG-- 186

  Fly   249 TTTENYKYLKSNPHI------CEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVY 307
               .|...|:.....      |:..||:::..: :.:.|.:|.:||:::|.:|:..|.:|.:.:.
  Rat   187 ---ANEAGLEDLVSALTCVGGCQIAVNQSWVFI-NFLLFLVPTLVMMTVYSKIFLIAKQQAQNIE 247

  Fly   308 RSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLWYIV 372
            :      :.::..:.|:..|.|           ..:||||||:||||.::|||:.|||:|:..|:
  Rat   248 K------MSKQTTRASESYKDR-----------VAKRERKAAKTLGIAVAAFLLSWLPYFIDSII 295

  Fly   373 SSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK-----------KTLKSLFP 424
            .:.. ..|||..:..||.||.|:|||:||:|||:|...||.|.|           .::.:|||
  Rat   296 DAFL-GFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRQNSSVTNLFP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 47/118 (40%)
7tm_1 124..404 CDD:278431 95/285 (33%)
Taar7aNP_783175.1 7tm_4 54..>184 CDD:304433 51/131 (39%)
7tm_1 64..326 CDD:278431 95/285 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.