DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar4

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_783173.1 Gene:Taar4 / 294122 RGDID:631382 Length:347 Species:Rattus norvegicus


Alignment Length:335 Identity:107/335 - (31%)
Similarity:165/335 - (49%) Gaps:62/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ALVFVKCFI--IGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASV 167
            |||....::  ||.|:: .:||||:||:|:...::|...||:.::|:|..|.|::...|.|:...
  Rat    30 ALVVCAMYLVMIGAIVM-TMLGNMVVIISIAHFKQLHSPTNFLILSMATTDFLLSCVVMPFSMVR 93

  Fly   168 MISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVW 232
            .|...|.||.:.|.:.:..|:...|.||.|||.|||||:||:..||.|...:|...|.:.||:.|
  Rat    94 SIESCWYFGDLFCKVHSCCDIMLCTTSIFHLCFISVDRHYAVCDPLHYVTQITVGVVGVFLLISW 158

  Fly   233 LSPALLSFLPI-----------------CSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMS 280
            ..|.|.:|..:                 |:|                :|....||.:.:::|.::
  Rat   159 SVPILFAFGLVFSELNLIGAEDFVAAIDCTG----------------LCVLIFNKLWGVLASFIA 207

  Fly   281 FWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTI-STMRR 344
            |::||.:|:.:|..|:..|.:..|     |:.             |.||....:.:|.: :|..:
  Rat   208 FFLPGAIMVGIYIHIFTVARKHAR-----KIG-------------PGPRTKRALSESKMKATSGK 254

  Fly   345 ERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCI---TPRLLVGILFWIGYFNSALNPIIYAY 406
            |.||.:||.|:|..|::||||||    |.::.|..|   ||..|..:..|:|||||..|||||..
  Rat   255 ESKATKTLSIVMGVFVLCWLPFF----VLTITDPFIGFTTPEDLYNVFLWLGYFNSTFNPIIYGM 315

  Fly   407 FNRDFRAAFK 416
            |...||.|.:
  Rat   316 FYPWFRKALR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 45/120 (38%)
7tm_1 124..404 CDD:278431 94/300 (31%)
Taar4NP_783173.1 7tm_1 50..313 CDD:278431 94/300 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.