DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Adrb3

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_008769537.1 Gene:Adrb3 / 25645 RGDID:2061 Length:421 Species:Rattus norvegicus


Alignment Length:352 Identity:133/352 - (37%)
Similarity:195/352 - (55%) Gaps:46/352 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 IILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCD 181
            :.||.:.||:|||.::.|..:|:.|||.||.|||.||::|.|..|...|::.::|.|..|:..|:
  Rat    65 LALATVGGNLLVITAIARTPRLQTITNVFVTSLATADLVVGLLVMPPGATLALTGHWPLGATGCE 129

  Fly   182 MWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSG 246
            :|.|.||...||||..||.::||||.|:..||.|..::|:||....:::||:..|.:||.||.|.
  Rat   130 LWTSVDVLCVTASIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSATVSFAPIMSQ 194

  Fly   247 WYTTTENYKYLK--SNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRS 309
            |:....:.:..:  |||..|.|..|..||::|||:||::|.:|||.:|.|::..|.||.||:.| 
  Rat   195 WWRVGADAEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLLRR- 258

  Fly   310 KVAALLLEKHLQISQIP---KPR-PSIQVEQSTISTM----------RR--------ERKAARTL 352
                       ::.:.|   .|| ||.....:|:.|.          ||        |.:|.|||
  Rat   259 -----------ELGRFPPEESPRSPSRSPSPATVGTPTASDGVPSCGRRPARLLPLGEHRALRTL 312

  Fly   353 GIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKK 417
            |:||..|.:|||||||..::.:|....:.|..:...|.|:||.|||.||:||.. :.|||.||::
  Rat   313 GLIMGIFSLCWLPFFLANVLRALVGPSLVPSGVFIALNWLGYANSAFNPLIYCR-SPDFRDAFRR 376

  Fly   418 TLKSLFPYAFYFCRRGRGRDDDRDLEF 444
            .|.|   |.      |||.::.|.:.|
  Rat   377 LLCS---YG------GRGPEEPRVVTF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 48/113 (42%)
7tm_1 124..404 CDD:278431 116/303 (38%)
Adrb3XP_008769537.1 7tm_1 72..364 CDD:278431 116/303 (38%)
7tm_4 72..>166 CDD:304433 43/93 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2359
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44908
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X822
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.