DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Drd5

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_036900.1 Gene:Drd5 / 25195 RGDID:2523 Length:475 Species:Rattus norvegicus


Alignment Length:377 Identity:132/377 - (35%)
Similarity:199/377 - (52%) Gaps:48/377 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 QAQDIQASEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRI-ITNYFVV 147
            |...:.|..||.... |.:.:    |...::..:|:..:|||:||..:::|.|.||. :||.|:|
  Rat    20 QLAQVDAPAGSATPL-GPAQV----VTAGLLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIV 79

  Fly   148 SLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQP 212
            ||||:|:.|||..|.:.|...::|.|.||: .||:|.:||:..|||||::||.||||||:||.:|
  Rat    80 SLAVSDLFVALLVMPWKAVAEVAGYWPFGT-FCDIWVAFDIMCSTASILNLCIISVDRYWAISRP 143

  Fly   213 LDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWY----------------TTTENYKYLKSNP 261
            ..|...||||...:|:.:.|....|:||:|:...|:                |..|....|:...
  Rat   144 FRYERKMTQRVALVMVGLAWTLSILISFIPVQLNWHRDKAGSQGQEGLLSNGTPWEEGWELEGRT 208

  Fly   262 HICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIP 326
            ..|:..:|:.|||.||.:||:||..:|:..|.|||:.|..|.|.:..       ||:..:.:|..
  Rat   209 ENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISS-------LERAAEHAQSC 266

  Fly   327 KPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDS-----------CI 380
            :.|.:.:.:.|..:::::|.|..:||.:||..|:.||||||:...:...|.|           |:
  Rat   267 RSRGAYEPDPSLRASIKKETKVFKTLSMIMGVFVCCWLPFFILNCMVPFCSSGDAEGPKTGFPCV 331

  Fly   381 TPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLFPYAFYFCRR 432
            : .....|..|.|:.||:||||||| ||.|||..|.:.|.     ..:||.|
  Rat   332 S-ETTFDIFVWFGWANSSLNPIIYA-FNADFRKVFAQLLG-----CSHFCFR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 55/119 (46%)
7tm_1 124..404 CDD:278431 111/307 (36%)
Drd5NP_036900.1 7tm_1 55..354 CDD:278431 111/307 (36%)
7tm_4 <121..>173 CDD:304433 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.