DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar5

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001009574.1 Gene:Taar5 / 215854 MGIID:2685073 Length:337 Species:Mus musculus


Alignment Length:321 Identity:108/321 - (33%)
Similarity:164/321 - (51%) Gaps:43/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMIS 170
            ::::.| .:|  :|..:|||:.|:.:|...:.|...||:.::|||:||||:.|..:..:....:.
Mouse    36 VIYLAC-AVG--VLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVE 97

  Fly   171 GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSP 235
            ..|.||..:|.:....|..|...||.|||.||:||:.||..||.||...|.|.....::..|..|
Mouse    98 SCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIP 162

  Fly   236 ALLS--FLPICSGWYTTTEN---YKYLKSNPHI--CEFKVNKAYAIVSSSMSFWIPGIVMLSMYY 293
            |..:  ||      ||....   .::|:..|.:  |:...||.:..::.. :|::|.::|:|:|.
Mouse   163 AAYTAFFL------YTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFP-AFFVPCLIMISLYL 220

  Fly   294 RIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSA 358
            :|:..|.||.:                ||..:         .||....::||||||:||||.:..
Mouse   221 KIFVVATRQAQ----------------QIRTL---------SQSLAGAVKRERKAAKTLGIAVGI 260

  Fly   359 FLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419
            :|:|||||.:..:|.||. :.|||.|:..|..|..|||||.|||||.:..|.||.|.|..|
Mouse   261 YLVCWLPFTVDTLVDSLL-NFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 41/118 (35%)
7tm_1 124..404 CDD:278431 96/286 (34%)
Taar5NP_001009574.1 7tm_1 51..305 CDD:278431 96/286 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.