DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar4

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001008499.1 Gene:Taar4 / 209513 MGIID:2685072 Length:347 Species:Mus musculus


Alignment Length:331 Identity:106/331 - (32%)
Similarity:162/331 - (48%) Gaps:54/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ALVFVKCFI--IGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASV 167
            |||....::  ||.|:: .:||||.||:|:...::|...||:.::|:|..|.|::...|.|:...
Mouse    30 ALVVCAMYLIMIGAIVM-TMLGNMAVIISIAHFKQLHSPTNFLILSMATTDFLLSCVVMPFSMIR 93

  Fly   168 MISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVW 232
            .|...|.||.:.|.:.:..|:...|.||.|||.|||||:||:..||.|...:|.|.|.:.||:.|
Mouse    94 SIESCWYFGDLFCKVHSCCDIMLCTTSIFHLCFISVDRHYAVCDPLHYVTQITTRVVGVFLLISW 158

  Fly   233 LSPALLSFLPI-----------------CSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMS 280
            ..|...:|..:                 |:|                :|....||.:.:::|.::
Mouse   159 SVPIFFAFGLVFSELNLIGAEDFVAAIDCTG----------------LCVLIFNKLWGVLASFIA 207

  Fly   281 FWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRE 345
            |::||.||:.:|..|:..|.:..|                ||...|:.:.::. |....:|.::|
Mouse   208 FFLPGTVMVGIYIHIFTVAQKHAR----------------QIGTGPRTKQALS-ESKMKATSKKE 255

  Fly   346 RKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRD 410
            .||.:||.|:|..|::||||||:..|.....| ..||..|..:..|:|||||..|||||..|...
Mouse   256 SKATKTLSIVMGVFVLCWLPFFVLTITDPFID-FTTPEDLYNVFLWLGYFNSTFNPIIYGMFYPW 319

  Fly   411 FRAAFK 416
            ||.|.:
Mouse   320 FRKALR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 46/120 (38%)
7tm_1 124..404 CDD:278431 93/296 (31%)
Taar4NP_001008499.1 7tm_4 34..>170 CDD:304433 49/136 (36%)
7tm_1 50..313 CDD:278431 93/296 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.