DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Drd1

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001278730.1 Gene:Drd1 / 13488 MGIID:99578 Length:446 Species:Mus musculus


Alignment Length:327 Identity:126/327 - (38%)
Similarity:187/327 - (57%) Gaps:18/327 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRI-ITNYFVVSLAVADMLVALCAMTFNASVMIS 170
            :...|| :..:||:.:|||.||..:|:|.|.||. :||:||:||||:|:|||:..|.:.|...|:
Mouse    23 ILTACF-LSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIA 86

  Fly   171 GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSP 235
            |.|.||| .|::|.:||:..|||||::||.||||||:||..|..|...||.:..||::.:.|...
Mouse    87 GFWPFGS-FCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFQYERKMTPKAAFILISVAWTLS 150

  Fly   236 ALLSFLPICSGWYTTTE------NYKYLK-SNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYY 293
            .|:||:|:...|:....      |:..|: :....|:.::::.|||.||.:||:||..:|:..|.
Mouse   151 VLISFIPVQLSWHKAKPTWPLDGNFTSLEDAEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYT 215

  Fly   294 RIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSA 358
            .||:.|.:|.|.:...:.||:..:.....:....|....|.|.|...:.:||.|..:||.:||..
Mouse   216 SIYRIAQKQIRRISALERAAVHAKNCQTTTGNGNPVECSQSESSFKMSFKRETKVLKTLSVIMGV 280

  Fly   359 FLICWLPFFLWYIVSSLCDS------CITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKK 417
            |:.||||||:...:...|.|      || ..:...:..|.|:.||:||||||| ||.||:.||..
Mouse   281 FVCCWLPFFISNCMVPFCGSEETQPFCI-DSITFDVFVWFGWANSSLNPIIYA-FNADFQKAFST 343

  Fly   418 TL 419
            .|
Mouse   344 LL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 58/119 (49%)
7tm_1 124..404 CDD:278431 111/293 (38%)
Drd1NP_001278730.1 7tm_1 39..331 CDD:278431 111/293 (38%)
7tm_4 40..>157 CDD:304433 57/117 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.