DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar1

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_444435.1 Gene:Taar1 / 111174 MGIID:2148258 Length:332 Species:Mus musculus


Alignment Length:312 Identity:111/312 - (35%)
Similarity:164/312 - (52%) Gaps:28/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGS 177
            ::..||||.::||::||:|:...::|...||:.:.|:|:.|.|:....|..:....:...|.||.
Mouse    28 LMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGE 92

  Fly   178 VMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLP 242
            ::|.:..|.|:..|:|||.||..||:|||.|:..||.|...:....:.:|:|:.|..||:.:|..
Mouse    93 ILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGM 157

  Fly   243 I-----CSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQ 302
            |     ..|   ..|.|:...|:...|....:|...:::...||:|||.|||.:|||||..|..|
Mouse   158 IFLELNLKG---VEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQ 219

  Fly   303 ERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFF 367
            .|.:.|:.|...|..|    ||.|:               .:|.|||:||||::..||:||.|||
Mouse   220 ARSINRTNVQVGLEGK----SQAPQ---------------SKETKAAKTLGIMVGVFLVCWCPFF 265

  Fly   368 LWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419
            |..::.......|.|. |...|:|.||.||||||::||:|...||.|.|..|
Mouse   266 LCTVLDPFLGYVIPPS-LNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 40/117 (34%)
7tm_1 124..404 CDD:278431 99/284 (35%)
Taar1NP_444435.1 7tm_4 37..316 CDD:304433 106/301 (35%)
7tm_1 39..301 CDD:278431 99/284 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.