DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar19g

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_009303916.2 Gene:taar19g / 103911784 ZFINID:ZDB-GENE-060413-17 Length:334 Species:Danio rerio


Alignment Length:325 Identity:94/325 - (28%)
Similarity:160/325 - (49%) Gaps:71/325 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FIILAA--ILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSV 178
            |.:|:|  :..|:|||:|:...:||...||..::||:|||:|:.| .|...|..:|...|.||..
Zfish    38 FPLLSAWTVFLNLLVIISISHFKKLHTPTNMIILSLSVADLLIGL-VMPIEAIRLIETCWYFGDT 101

  Fly   179 MCDMWNSFDVY----FSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWL-SPALL 238
            .|    .|::.    ..:||:.:|..|:||||.|:..||.||..:|...:.|.:.:.|: ..|..
Zfish   102 FC----GFNLIIIGAILSASVSNLVLIAVDRYVAVCYPLLYPQKITISNMLISICLSWVYYSAYN 162

  Fly   239 SFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSF-WI----------PGIVMLSMY 292
            :.|.|.:|::.|:              ::.:..|...|:.||| ||          |.::::::|
Zfish   163 TVLIINNGYFDTS--------------YRTDMCYGQCSAMMSFTWILTDLFVCFTFPCVIIITLY 213

  Fly   293 YRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRR--ERKAARTLGII 355
            .||:....:|.::                |:.:.|....:     |..:::|  |.|||.|||||
Zfish   214 LRIFYVVHQQVKV----------------INSLMKGGKCV-----TDGSVKRKSESKAALTLGII 257

  Fly   356 MSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLK 420
            :|.:::||:|::       :|...:....::.:|.|:.|.||.|||::||.    |...||||:|
Zfish   258 VSVYMLCWIPYY-------ICALSVNSSTVLSVLTWVVYANSGLNPLVYAL----FYPWFKKTVK 311

  Fly   421  420
            Zfish   312  311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 42/120 (35%)
7tm_1 124..404 CDD:278431 83/297 (28%)
taar19gXP_009303916.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.