DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar20w

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_009303898.1 Gene:taar20w / 103911778 ZFINID:ZDB-GENE-060414-8 Length:332 Species:Danio rerio


Alignment Length:332 Identity:99/332 - (29%)
Similarity:164/332 - (49%) Gaps:62/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GFIIL---AAILG------NMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMIS 170
            |:||:   |::|.      |:|||:|:...:||...||..::||||.|:|:.: .|...|.....
Zfish    30 GYIIIYLFASLLSAWTVFLNLLVIISISHFKKLHTPTNMIILSLAVNDLLIGV-VMPIEAIRQTE 93

  Fly   171 GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYP--LIMTQRRVFIMLLMVWL 233
            ..|.||::.|.::..|.....:||:.:|..|:||||.|:..||.||  :.:|:..:.|.|..|||
Zfish    94 TCWYFGNIFCGLYLLFISLLMSASLSNLVLIAVDRYVAVCHPLLYPQKITITKTLMIICLSWVWL 158

  Fly   234 SPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSS-------MSFWIPGIVMLSM 291
            |...::.| |.:|::.|:          |..:....:..||:|.|       |||..|..:::.:
Zfish   159 SAYSIALL-INNGYFDTS----------HRSDECYGECLAIISFSWIITDLFMSFMFPCPLIMML 212

  Fly   292 YYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRR--ERKAARTLGI 354
            |.||:....:|.::                |:.:.|....:     |..:::|  |.|||.||||
Zfish   213 YLRIFYVVHQQVKV----------------INSLMKGGKCV-----TEGSVKRKSESKAALTLGI 256

  Fly   355 IMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK--K 417
            |::.:::||:|::       :|...:.....:.::.|..|.||||||::||.|...|:...|  .
Zfish   257 IVAVYMLCWIPYY-------ICSLIVISSTAMIVIIWAVYANSALNPLVYALFYPWFKKTAKLIV 314

  Fly   418 TLKSLFP 424
            |||.|.|
Zfish   315 TLKILQP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 43/126 (34%)
7tm_1 124..404 CDD:278431 84/296 (28%)
taar20wXP_009303898.1 7tm_4 46..>178 CDD:304433 47/143 (33%)
7tm_1 49..299 CDD:278431 84/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.