DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar12a

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076578.1 Gene:taar12a / 100034659 ZFINID:ZDB-GENE-041014-99 Length:343 Species:Danio rerio


Alignment Length:326 Identity:103/326 - (31%)
Similarity:165/326 - (50%) Gaps:48/326 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LALVFVKCFI-IGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASV 167
            ||:|.|..:: :..:||..:.||:::|:|:...:.|:..|:..|.|||..|.|:....|.::...
Zfish    38 LAVVQVGLYVFLLLMILTTVFGNLMIIISISHFKHLQSPTHLIVQSLAACDCLMGSLVMPYSMVR 102

  Fly   168 MISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVW 232
            .:.|.|..|.|:|.:..||||.|..:|::|||.||||||.||..||.|.:.:|...:.:.::.:|
Zfish   103 SVEGCWYLGDVVCKVHFSFDVTFCISSLLHLCLISVDRYLAICDPLRYKIRVTNTTMTVFIIFIW 167

  Fly   233 LSPALLSFLPICSGWYTTTENYKYLKSNPHI---CEFKVNKAYAIVSSSMSFWIPGIVMLSMYYR 294
            |...:.||..:.||  .|....:.|....:.   |....||.:| |...::|:|.|.:|.|:|.:
Zfish   168 LFSVVYSFSIVFSG--ITAVGLEMLILQTYCVGSCVLFFNKEWA-VYPFLTFFITGAIMSSLYMK 229

  Fly   295 IYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAF 359
            |:..|                 .||.::.. .:.:..::.::|.    :||||||:||.|:|..|
Zfish   230 IFHVA-----------------RKHAKVMS-ERVKGGLKSQRSA----QRERKAAKTLAIVMGVF 272

  Fly   360 LICWL---------PFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAF 415
            :.|||         |||.:...:.:.|          :|||..||||:.||:||.:|...|:.||
Zfish   273 MFCWLPYCAFTALYPFFTFLNSAEVFD----------VLFWFAYFNSSCNPLIYGFFYPCFQKAF 327

  Fly   416 K 416
            |
Zfish   328 K 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 41/119 (34%)
7tm_1 124..404 CDD:278431 90/291 (31%)
taar12aNP_001076578.1 7tm_4 57..328 CDD:304433 95/305 (31%)
7tm_1 59..316 CDD:278431 90/291 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.