DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar12c

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076564.1 Gene:taar12c / 100034601 ZFINID:ZDB-GENE-041014-66 Length:338 Species:Danio rerio


Alignment Length:330 Identity:100/330 - (30%)
Similarity:162/330 - (49%) Gaps:31/330 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 HLALVFVKCFI-IGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNAS 166
            |..:|.|..:: :..:||..:.||:|:|:|:...:.|:..|:..|.|||.:|.|:....|.::..
Zfish    27 HFVVVKVAMYVCLLLMILTTVFGNLLIIISISHFKHLQSPTHLIVRSLAASDCLLGSLVMPYSMV 91

  Fly   167 VMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMV 231
            ..:.|.|..|.|:|.:.:|.|:.|..:|::||..||||||:||..||.|.|.:|...|.:..:.:
Zfish    92 RSVEGCWYLGDVVCKVHSSLDMTFCISSLLHLGLISVDRYWAICDPLRYRLRVTNTTVTVFTVFI 156

  Fly   232 WLSPALLSFLPICSGWYTTTENYKYLKSN-PHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRI 295
            ||...:.||..:.||..........|::. ...|....||.:.::...::|::||.:|..:|.:|
Zfish   157 WLFAFVYSFSVVFSGIAAVGLEMLILQTYCVGSCVLFFNKEWGLICPILTFFLPGAIMSFLYMKI 221

  Fly   296 YQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFL 360
            :..| |:...|...:|...|..:                     |:.:||||||:||.|:|..|:
Zfish   222 FHVA-RKHAKVMSERVTGGLKSQ---------------------SSAQRERKAAKTLAIVMGVFM 264

  Fly   361 ICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLFPY 425
            .||||:|...|:....:.. ||..:...|.|..|.||..||:||.:|...|:.||...:.:    
Zfish   265 FCWLPYFTVTILGPFFNFA-TPADVFDALVWFAYLNSTCNPLIYGFFYPCFQKAFHILIST---- 324

  Fly   426 AFYFC 430
              |.|
Zfish   325 --YIC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 41/119 (34%)
7tm_1 124..404 CDD:278431 87/280 (31%)
taar12cNP_001076564.1 7tm_4 47..318 CDD:304433 91/293 (31%)
7tm_1 49..307 CDD:278431 87/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.