DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar13c

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076509.1 Gene:taar13c / 100034378 ZFINID:ZDB-GENE-041014-60 Length:341 Species:Danio rerio


Alignment Length:339 Identity:107/339 - (31%)
Similarity:173/339 - (51%) Gaps:62/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFN 164
            |:.|::...|...|:...:...:|||.:||:|:...::|:..||..|:|||:||:|:.|..|.|:
Zfish    25 GTHHVSTQTVVYLILASAMTVTVLGNSVVIISIAHFKQLQTPTNILVMSLALADLLLGLVVMPFS 89

  Fly   165 ASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLL 229
            ....:.|.|.:|...|.:...||::.::.||.||..|:|||:.|:..||.||..:|....::|::
Zfish    90 MIRSVDGCWYYGETFCLLHTGFDLFLTSVSIFHLIFIAVDRHQAVCFPLQYPTRITIPVAWVMVM 154

  Fly   230 MVWLSPALLSFLPICSGWYTTTENYKYLKSN-----PHI--------CEFKVNKAYAIVSSSMSF 281
            :.|...|..|:            ...|.|:|     .:|        |....|..::::.:.::|
Zfish   155 ISWSMAAFYSY------------GVVYSKANLEGLEEYIASVYCMGGCTLYFNALWSVLDTLLTF 207

  Fly   282 WIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQ-ISQIPKPRPSIQVEQSTI--STMR 343
            ::|..||:.:|.||:                 ::.:||:: |::      :.|.|...:  :..|
Zfish   208 FLPCSVMVGLYARIF-----------------VVAKKHIKSITE------ANQNENENVFKNPRR 249

  Fly   344 RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCI---TPRLLVGILFWIGYFNSALNPIIYA 405
            .|||||:||||::.||::||||||    ::||.|..|   ||..|.....|:||.||.||||||.
Zfish   250 SERKAAKTLGIVVGAFILCWLPFF----INSLVDPYINFSTPYALFDAFGWLGYTNSTLNPIIYG 310

  Fly   406 YFNRDFRAAFKKTL 419
            .|...||    |||
Zfish   311 LFYPWFR----KTL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 41/118 (35%)
7tm_1 124..404 CDD:278431 94/298 (32%)
taar13cNP_001076509.1 7tm_1 49..309 CDD:278431 94/298 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.