DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and hrh2b

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001103208.1 Gene:hrh2b / 100005590 ZFINID:ZDB-GENE-070928-20 Length:335 Species:Danio rerio


Alignment Length:357 Identity:121/357 - (33%)
Similarity:179/357 - (50%) Gaps:51/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMI 169
            ||.:|  .::.||.| .|.||:||.::|...|:|..:::.|::||||.|:|:.|..:..:|.:.:
Zfish     5 ALCWV--VLVAFIAL-TICGNILVCMAVATSRRLHQLSSCFILSLAVTDLLLGLLVLPLSAMLEL 66

  Fly   170 -SGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWL 233
             :|||..|.|.|:::.|.||..|:|||:.|..||||||.||..||.||..:|.|||.|.|..:|.
Zfish    67 RNGKWPLGGVFCNIYISMDVMLSSASILTLLAISVDRYLAISNPLFYPRRVTPRRVAIALTAIWT 131

  Fly   234 SPALLSFLPICSGWYTTTENYKYLK-------SNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSM 291
            ....:||:.|..||.:.....:.|.       .....|.::.|..|.::.:...|::|.:||..|
Zfish   132 CSLAVSFVSINLGWNSPDFRVQNLDWSMWGEGEEGRTCRYEWNNNYVLLKAFGIFYLPLLVMCGM 196

  Fly   292 YYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIM 356
            |:||:..|..|.|                   :|....|| ..:.:..:...||.||..||..::
Zfish   197 YHRIFCVAREQVR-------------------RIRAATPS-SAQAANAAATAREHKATVTLAAVL 241

  Fly   357 SAFLICWLPFFLWYIVSSLCDSCITP-RLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLK 420
            .||:|||.|:|.::....:.  .|.| :|...|:.|:||.|||||||:|...||||..|..:.| 
Zfish   242 GAFIICWFPYFTYFTYMGMW--AIHPNKLTHSIVLWLGYLNSALNPILYPALNRDFHQACGQLL- 303

  Fly   421 SLFPYAFYFCRRGRGRDDDRDLEFGGPSRRGT 452
                     ||.|:..|.:       .|||.|
Zfish   304 ---------CRCGKKGDFN-------TSRRKT 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 52/119 (44%)
7tm_1 124..404 CDD:278431 99/288 (34%)
hrh2bNP_001103208.1 7tm_1 21..288 CDD:278431 99/288 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.