DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and NHP6B

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_009647.2 Gene:NHP6B / 852386 SGDID:S000002157 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:23/71 - (32%)
Similarity:39/71 - (54%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||:.:||:|.:.|. .|..:|:|:||.:..:|....||.|:|:..|.|..::..|......|:.:
Yeast    27 PKRGLSAYMFFANE-NRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESE 90

  Fly    74 LEKWNA 79
            .|.:||
Yeast    91 KELYNA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 20/65 (31%)
NHP6BNP_009647.2 NHP6B 1..>99 CDD:227935 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I1797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.