DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and NHP10

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_010282.3 Gene:NHP10 / 851562 SGDID:S000002160 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:16/72 - (22%)
Similarity:38/72 - (52%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLW--MNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYK 71
            ||:|.:|::|:  ||   ::.|| ::....|.....:|   |:.:.::.:..:.:..|:....|:
Yeast    94 PKRPTNAYLLYCEMN---KERIR-QNGSLDVTRDLAEG---WKNLNEQDRKPYYKLYSEDRERYQ 151

  Fly    72 EKLEKWN 78
            .::|.:|
Yeast   152 MEMEIYN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 14/67 (21%)
NHP10NP_010282.3 NHP6B 24..203 CDD:227935 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.