DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and NHP10

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_010282.3 Gene:NHP10 / 851562 SGDID:S000002160 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:16/72 - (22%)
Similarity:38/72 - (52%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLW--MNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYK 71
            ||:|.:|::|:  ||   ::.|| ::....|.....:|   |:.:.::.:..:.:..|:....|:
Yeast    94 PKRPTNAYLLYCEMN---KERIR-QNGSLDVTRDLAEG---WKNLNEQDRKPYYKLYSEDRERYQ 151

  Fly    72 EKLEKWN 78
            .::|.:|
Yeast   152 MEMEIYN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 13/68 (19%)
NHP10NP_010282.3 NHP6B 24..203 CDD:227935 16/72 (22%)

Return to query results.
Submit another query.