DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and SOX14

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_004180.1 Gene:SOX14 / 8403 HGNCID:11193 Length:240 Species:Homo sapiens


Alignment Length:74 Identity:21/74 - (28%)
Similarity:37/74 - (50%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEKL 74
            |:||:|||:|.....|| :..|:|.....|:|.:.|..|:.:::..|..:.:.|.:..|::    
Human     9 KRPMNAFMVWSRGQRRK-MAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQH---- 68

  Fly    75 EKWNAFKEH 83
                 .|||
Human    69 -----MKEH 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 17/66 (26%)
SOX14NP_004180.1 HMG-box_SoxB 6..85 CDD:438790 21/74 (28%)
SOXp 77..>118 CDD:463537
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.