DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and AT1G04880

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_171980.1 Gene:AT1G04880 / 839388 AraportID:AT1G04880 Length:448 Species:Arabidopsis thaliana


Alignment Length:97 Identity:21/97 - (21%)
Similarity:44/97 - (45%) Gaps:7/97 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||...|.:..:. :.....::..||. ..:::|...||:|..:.::.|:::|..|.:....|:.:
plant   263 PKPNRSGYNFFF-AEQHARLKPLHPG-KDRDISRMIGELWNKLNEDEKLIYQGKAMEDKERYRTE 325

  Fly    74 LEKWNAFKEH-QTESFPHIYEAPLSSRFSKTN 104
            :|.:...|:: |..|    ...||..|..:.|
plant   326 MEDYREKKKNGQLIS----NAVPLQQRLPEQN 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 12/66 (18%)
AT1G04880NP_171980.1 ARID_HMGB9-like 31..116 CDD:350636
HMG-box_AtHMGB9-like 263..329 CDD:438825 14/67 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.