DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and HMGB2

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_564123.1 Gene:HMGB2 / 838658 AraportID:AT1G20693 Length:144 Species:Arabidopsis thaliana


Alignment Length:72 Identity:22/72 - (30%)
Similarity:41/72 - (56%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHP-DFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYK 71
            :||:|.|||.::|... |:..:.|:| :.||..|....|:.|::::|..|..:...|.|...||:
plant    37 KPKRPASAFFVFMEDF-RETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYE 100

  Fly    72 EKLEKWN 78
            :.::.:|
plant   101 KNIKAYN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 19/67 (28%)
HMGB2NP_564123.1 HMG-box_AtHMGB1-like 39..99 CDD:438821 18/60 (30%)

Return to query results.
Submit another query.