DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Tfam

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_112616.2 Gene:Tfam / 83474 RGDID:620682 Length:244 Species:Rattus norvegicus


Alignment Length:85 Identity:29/85 - (34%)
Similarity:42/85 - (49%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDYGARPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAM 67
            |..|..||||||:::.:......| .:|:|||..|.|:..|...|||.:.:..|.|::.......
  Rat    43 SSLGNYPKKPMSSYLRFSTEQLPK-FKAKHPDAKVSELIRKIAAMWRELPEAEKKVYEADFKAEW 106

  Fly    68 AEYKEKLEKWNAFKEHQTES 87
            ..|||.:.|   :||..|.|
  Rat   107 KVYKEAVSK---YKEQLTPS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 22/65 (34%)
TfamNP_112616.2 NHP6B <46..215 CDD:227935 28/82 (34%)
HMG_box 49..116 CDD:395407 23/70 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.