DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and 3xHMG-box2

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:154 Identity:42/154 - (27%)
Similarity:63/154 - (40%) Gaps:58/154 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASK------- 65
            :||.|:|||:::.|.. |..:|.|:.  ||.||:...||.|:.::|:.|..:::.|.|       
plant   254 KPKHPVSAFLVYANER-RAALREENK--SVVEVAKITGEEWKNLSDKKKAPYEKVAKKNKETYLQ 315

  Fly    66 AMAEYK---------EKLEKWNAFKEHQTESF----------------------------PHIYE 93
            ||.|||         :|.|:....|.|:.|:.                            |:..:
plant   316 AMEEYKRTKEEEALSQKKEEEELLKLHKQEALQMLKKKEKTDNLIKKEKATKKKKNENVDPNKPK 380

  Fly    94 APLSSRFSKTNQRPTLFVYDSKDE 117
            .|.||.|        ||   ||||
plant   381 KPASSYF--------LF---SKDE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 27/81 (33%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 42/154 (27%)
HMGB-UBF_HMG-box 139..203 CDD:238686
HMG-box 255..320 CDD:381793 23/67 (34%)
HMGB-UBF_HMG-box 379..444 CDD:238686 10/26 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.