DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and 3xHMG-box1

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:74 Identity:23/74 - (31%)
Similarity:41/74 - (55%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKE 72
            :||||.|::.|:... .||::..|||..:...|:......|..:.:|.|.|:...|::.|..||:
plant   371 KPKKPTSSYFLFCKD-ARKSVLEEHPGINNSTVTAHISLKWMELGEEEKQVYNSKAAELMEAYKK 434

  Fly    73 KLEKWNAFK 81
            ::|::|..|
plant   435 EVEEYNKTK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 20/65 (31%)
3xHMG-box1NP_192846.1 HMGB-UBF_HMG-box 130..193 CDD:238686
HMGB-UBF_HMG-box 246..309 CDD:238686
HMGB-UBF_HMG-box 372..437 CDD:238686 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.