DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and 3xHMG-box1

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:74 Identity:23/74 - (31%)
Similarity:41/74 - (55%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKE 72
            :||||.|::.|:... .||::..|||..:...|:......|..:.:|.|.|:...|::.|..||:
plant   371 KPKKPTSSYFLFCKD-ARKSVLEEHPGINNSTVTAHISLKWMELGEEEKQVYNSKAAELMEAYKK 434

  Fly    73 KLEKWNAFK 81
            ::|::|..|
plant   435 EVEEYNKTK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 19/66 (29%)
3xHMG-box1NP_192846.1 PTZ00121 <11..361 CDD:173412
HMG-box_AtHMGB6-like_rpt1 130..197 CDD:438822
HMG-box_AtHMGB6-like_rpt2 246..311 CDD:438823
HMG-box_AtHMGB6-like_rpt3 363..440 CDD:438824 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.