DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and HMGB1

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_974413.1 Gene:HMGB1 / 824351 AraportID:AT3G51880 Length:185 Species:Arabidopsis thaliana


Alignment Length:82 Identity:25/82 - (30%)
Similarity:48/82 - (58%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDF-SVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYK 71
            :||:..|||.:::... |...:.|:|:. :|..|...||:.|::|:...|..::|.|:|..|||:
plant    52 KPKRAPSAFFVFLEDF-RVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAAKRKAEYE 115

  Fly    72 EKLEKWNA-FKEHQTES 87
            ::::.:|. .:|...||
plant   116 KQMDAYNKNLEEGSDES 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 19/67 (28%)
HMGB1NP_974413.1 PRK05901 1..>171 CDD:235640 25/82 (30%)
HMG-box_AtHMGB1-like 54..114 CDD:438821 18/60 (30%)

Return to query results.
Submit another query.