DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and HMGB4

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001031364.2 Gene:HMGB4 / 816263 AraportID:AT2G17560 Length:138 Species:Arabidopsis thaliana


Alignment Length:72 Identity:23/72 - (31%)
Similarity:37/72 - (51%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHP-DFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYK 71
            :||:|.|||.:::... ||.....:| :.||..|....|..|:||.||.|..:...|.....||.
plant    34 QPKRPPSAFFVFLEDF-RKEFNLANPNNKSVATVGKAAGARWKAMTDEDKAPYVAKAESRKTEYI 97

  Fly    72 EKLEKWN 78
            :.::::|
plant    98 KNVQQYN 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 22/66 (33%)
HMGB4NP_001031364.2 HMG_box 35..103 CDD:278906 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.