DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and sox1

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001074465.1 Gene:sox1 / 779569 XenbaseID:XB-GENE-1018269 Length:401 Species:Xenopus tropicalis


Alignment Length:76 Identity:23/76 - (30%)
Similarity:37/76 - (48%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKE 72
            |.|:||:|||:|.....|| :..|:|.....|:|.:.|..|:.|::..|..:.:.|.:..|.:  
 Frog    36 RVKRPMNAFMVWSRGQRRK-MAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALH-- 97

  Fly    73 KLEKWNAFKEH 83
                   .|||
 Frog    98 -------MKEH 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 18/66 (27%)
sox1NP_001074465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 1/1 (100%)
HMG-box_SoxB 35..114 CDD:438790 23/76 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..343
9aaTAD. /evidence=ECO:0000250|UniProtKB:P41225 345..353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.