DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Hmgb4

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001102933.1 Gene:Hmgb4 / 685271 RGDID:1596426 Length:181 Species:Rattus norvegicus


Alignment Length:87 Identity:24/87 - (27%)
Similarity:47/87 - (54%) Gaps:11/87 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSDYGAR----------PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEH 55
            ||:..|.|          |:||.|:|:|:......| ::.|:|:::|.:|:...|:||..:.|..
  Rat    75 MMNYVGKRRKRRKRDPLAPRKPPSSFLLFSLDHFAK-LKQENPNWTVVQVAKAAGKMWSMITDVD 138

  Fly    56 KIVWQESASKAMAEYKEKLEKW 77
            |..:::.|:...|:|.::.|.:
  Rat   139 KRPYEQKAAIMRAKYFQEREAY 160

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 19/67 (28%)