DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and SOX12

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens


Alignment Length:67 Identity:24/67 - (35%)
Similarity:35/67 - (52%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESAS----KAMAEY 70
            |:||:|||:|.....|| |..:.||....|:|.:.|..|:.:.|..||.:...|.    |.||:|
Human    41 KRPMNAFMVWSQHERRK-IMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADY 104

  Fly    71 KE 72
            .:
Human   105 PD 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 23/66 (35%)
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
HMG-box_SF 29..116 CDD:469606 24/67 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 3/7 (43%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.