DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and SOX3

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_005625.2 Gene:SOX3 / 6658 HGNCID:11199 Length:446 Species:Homo sapiens


Alignment Length:69 Identity:22/69 - (31%)
Similarity:35/69 - (50%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKA----MA 68
            |.|:||:|||:|.....|| :..|:|.....|:|.:.|..|:.:.|..|..:.:.|.:.    |.
Human   138 RVKRPMNAFMVWSRGQRRK-MALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMK 201

  Fly    69 EYKE 72
            ||.:
Human   202 EYPD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 20/66 (30%)
SOX3NP_005625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..140 1/1 (100%)
HMG-box_SoxB 137..212 CDD:438790 22/69 (32%)
SOXp 208..302 CDD:463537
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 399..407
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.