DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and SOX1

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_005977.2 Gene:SOX1 / 6656 HGNCID:11189 Length:391 Species:Homo sapiens


Alignment Length:76 Identity:23/76 - (30%)
Similarity:37/76 - (48%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKE 72
            |.|:||:|||:|.....|| :..|:|.....|:|.:.|..|:.|::..|..:.:.|.:..|.:  
Human    50 RVKRPMNAFMVWSRGQRRK-MAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALH-- 111

  Fly    73 KLEKWNAFKEH 83
                   .|||
Human   112 -------MKEH 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 18/66 (27%)
SOX1NP_005977.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 1/1 (100%)
HMG-box_SoxB 49..128 CDD:438790 23/76 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249
9aaTAD. /evidence=ECO:0000250|UniProtKB:P41225 342..350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.