DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and UBTFL1

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001137447.1 Gene:UBTFL1 / 642623 HGNCID:14533 Length:393 Species:Homo sapiens


Alignment Length:99 Identity:27/99 - (27%)
Similarity:45/99 - (45%) Gaps:11/99 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGARPKKPMSAF-MLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMA 68
            :|...|.||:.: ....:|...|.:  :|  .||:|..|:.|..|:.:....|..::..|.:...
Human   218 HGEPQKPPMNGYHKFHQDSWSSKEM--QH--LSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQK 278

  Fly    69 EYKEKLEKWNAFKEHQTESFPHIYEAPLSSRFSK 102
            :||.||:.|     .:|.| |..|.|...|.::|
Human   279 QYKVKLDLW-----LKTLS-PENYAAYKESTYAK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 17/66 (26%)
UBTFL1NP_001137447.1 HMGB-UBF_HMG-box 100..165 CDD:238686
HMGB-UBF_HMG-box 223..285 CDD:238686 17/65 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.