powered by:
Protein Alignment tHMG2 and hmgb3b
DIOPT Version :9
Sequence 1: | NP_001163689.1 |
Gene: | tHMG2 / 42651 |
FlyBaseID: | FBgn0038979 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017769.1 |
Gene: | hmgb3b / 550466 |
ZFINID: | ZDB-GENE-050417-290 |
Length: | 198 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 39/72 - (54%) |
Gaps: | 5/72 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
|::|.|.|.|:. :..|..|:|::|...:.:|:.|.|.||..::|..|..:..:|.| .|:|
Zfish 94 PRRPPSGFFLFC-AEQRPIIKAQNPSLGIGDVAKKLGGMWNNLSDSEKQPFLSNADK----LKDK 153
Fly 74 LEKWNAF 80
.:|..||
Zfish 154 YQKDMAF 160
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.