DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Ubtfl1

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001028965.1 Gene:Ubtfl1 / 546118 MGIID:3588290 Length:394 Species:Mus musculus


Alignment Length:111 Identity:22/111 - (19%)
Similarity:51/111 - (45%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSDYGARPKKPMSAFMLWMNSTGRKNIRAE----HPDFSVQEVSVKGGEMWRAMADEHKIVWQE 61
            :::::..|||:|::|::.:.     |..||:    :|.:|..:::....|.:|.:..|.|..:..
Mouse    93 ILTEHPDRPKRPLTAYLRFY-----KEQRAKYCQMYPKYSNAQLTKILAEKYRQLPAEIKQRYIM 152

  Fly    62 SASKAMAEYKEKLEKWNAFKEHQTESFP--------HIYEAPLSSR 99
            ...|...::::|:.::.  |.|.....|        |..:.|..|:
Mouse   153 DFKKEKEDFQKKMRQFK--KRHPVSGHPKKSVVPQSHPTKVPTKSQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 13/70 (19%)
Ubtfl1NP_001028965.1 HMG-box_UBF1_rpt1-like 98..173 CDD:438814 17/81 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..197 6/32 (19%)
HMG-box_UBF1_rpt6-like 222..306 CDD:438819
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..394
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.