DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and hmgb3

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001004888.1 Gene:hmgb3 / 448228 XenbaseID:XB-GENE-1002014 Length:202 Species:Xenopus tropicalis


Alignment Length:86 Identity:29/86 - (33%)
Similarity:41/86 - (47%) Gaps:16/86 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSDYGA-----------RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEH 55
            |.|:|.           .||:|.|.|.|:. |..|..|::.:|..|:.:|:.|.||||..:.|..
 Frog    75 MKDFGPVKKGKKKKDPNAPKRPPSGFFLFC-SEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGE 138

  Fly    56 KIVWQESASKAMAEYKEKLEK 76
            |..:...|:|    .|||.||
 Frog   139 KQPYNNKAAK----LKEKYEK 155

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 24/66 (36%)