DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Sox102F

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster


Alignment Length:64 Identity:21/64 - (32%)
Similarity:34/64 - (53%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            |:||:|||:|.....||.::| .||.....:|...|..|:||::..|..:.|..|:....:.|:
  Fly   424 KRPMNAFMVWAKDERRKILKA-CPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQ 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 20/63 (32%)
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 21/64 (33%)

Return to query results.
Submit another query.