DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and sox17b.1

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_988849.1 Gene:sox17b.1 / 394440 XenbaseID:XB-GENE-484865 Length:376 Species:Xenopus tropicalis


Alignment Length:91 Identity:23/91 - (25%)
Similarity:43/91 - (47%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ARPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAE-- 69
            ||.::||:|||:|.... ||.:..::||....|:|...|:.|:::....|..:.|.|.:...:  
 Frog    56 ARIRRPMNAFMVWAKDE-RKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVEEAERLRVQHI 119

  Fly    70 -------YKEKLEKWNAFKEHQTESF 88
                   |:.:.:|.....:.:.|.|
 Frog   120 QDYPDYKYRPRRKKQVKRMKREEEGF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 18/74 (24%)
sox17b.1NP_988849.1 SOX-TCF_HMG-box 57..128 CDD:238684 18/71 (25%)
PABP-1234 <80..250 CDD:130689 13/66 (20%)
Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:O42601 327..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.