DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and ubtfl

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_957297.1 Gene:ubtfl / 393978 ZFINID:ZDB-GENE-040426-1159 Length:719 Species:Danio rerio


Alignment Length:131 Identity:31/131 - (23%)
Similarity:54/131 - (41%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGARPKK-PMSAFMLW---MNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASK 65
            :...||| |:|.:.::   :.:.|..|      .||::|..|:.|:.|..::...|..:::...:
Zfish   521 FDGEPKKPPVSGYQMFSQELLTNGELN------HFSLKERMVEIGKRWHKLSQSQKDKYKKQVEE 579

  Fly    66 AMAEYKEKLEKWNAFKEHQTESFPHIYEAPLSSRFSKTNQRPTLFVYDSKDEAMAPICRTCFSKA 130
            ...|||.:||.|......|        |..:...||.|.:|.|       .:|..|..:...:|.
Zfish   580 QQLEYKAELEAWVKSLSPQ--------ERAVYKEFSSTKRRST-------TKARGPGAKVRVTKG 629

  Fly   131 K 131
            |
Zfish   630 K 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 17/69 (25%)
ubtflNP_957297.1 HMGB-UBF_HMG-box 114..179 CDD:238686
HMGB-UBF_HMG-box 198..263 CDD:238686
HMGB-UBF_HMG-box 299..359 CDD:238686
HMG-box 433..509 CDD:294061
HMGB-UBF_HMG-box 527..589 CDD:238686 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.