DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Ssrp

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster


Alignment Length:96 Identity:31/96 - (32%)
Similarity:55/96 - (57%) Gaps:17/96 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKE 72
            :||:..:|||||:|.| |::|:.|:|...|.|::.||||||:.:.|:.|  |:::|:|....|.:
  Fly   554 KPKRATTAFMLWLNDT-RESIKRENPGIKVTEIAKKGGEMWKELKDKSK--WEDAAAKDKQRYHD 615

  Fly    73 KLEKW--------------NAFKEHQTESFP 89
            ::..:              .:.|:.:||..|
  Fly   616 EMRNYKPEAGGDSDNEKGGKSSKKRKTEPSP 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 25/80 (31%)
SsrpNP_523830.2 POB3 20..499 CDD:227494
HMG-box_SSRP1-like 557..621 CDD:438810 25/66 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.