DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and HMGB3

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001288160.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:220 Species:Homo sapiens


Alignment Length:86 Identity:32/86 - (37%)
Similarity:43/86 - (50%) Gaps:16/86 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSDYGA-----------RPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEH 55
            |.|||.           .||:|.|.|.|:. |..|..|::.:|..|:.:|:.|.||||..:.|..
Human    95 MKDYGPAKGGKKKKDPNAPKRPPSGFFLFC-SEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSE 158

  Fly    56 KIVWQESASKAMAEYKEKLEK 76
            |   |...:|| |:.|||.||
Human   159 K---QPYITKA-AKLKEKYEK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 26/65 (40%)
HMGB3NP_001288160.1 HMG_box_2 33..98 CDD:370242 1/2 (50%)
HMG_box 113..180 CDD:366139 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.