DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and HMGB2

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_002120.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:124 Identity:25/124 - (20%)
Similarity:45/124 - (36%) Gaps:23/124 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GPKHISWHELEKEGLPSGTTAV--VNLAGQNVLDPTRRWTPGFKQNVWNSRINTTAACARAIERA 98
            ||..:||.|| ..|:|:...|.  .|:....::           .|:.::.|......:..:.|.
Human   840 GPTVVSWLEL-WVGMPAWYVAACRANVKSGAIM-----------ANLSDTEIQREIGISNPLHRL 892

  Fly    99 TVKPAVFVNISGVSHYAPGSQK---------HTELSKVSDYDFMSRLCIEWERAATLSD 148
            .::.|:...:|..|..||.|.:         |.|:..::.........|.||:.....|
Human   893 KLRLAIQEMVSLTSPSAPASSRTPTGNVWMTHEEMESLTAATKPETKEISWEQILAYGD 951

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 10/43 (23%)
HMGB2NP_002120.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150
HMG-box_HMGB_rpt2 93..163 CDD:438795
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.