DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tHMG2 and HMGB2

DIOPT Version :9

Sequence 1:	NP_001163689.1	Gene:	tHMG2 / 42651	FlyBaseID:	FBgn0038979	Length:	134	Species:	Drosophila melanogaster
Sequence 2:	NP_001124160.1	Gene:	HMGB2 / 3148	HGNCID:	5000	Length:	209	Species:	Homo sapiens

Alignment Length:	71	Identity:	24/71 - (33%)
Similarity:	42/71 - (59%)	Gaps:	1/71 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||:|.|||.|:. |..|..|::|||..|:.:.:.|.||||...:.:.|..:::.|:|...:|::.
Human    95 PKRPPSAFFLFC-SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKD 158

  Fly    74 LEKWNA 79
            :..:.|
Human   159 IAAYRA 164

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tHMG2	NP_001163689.1	HMGB-UBF_HMG-box	9..75	CDD:238686	23/65 (35%)
HMGB2	NP_001124160.1	HMG_box_2	6..78	CDD:401091
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	52..150		21/55 (38%)
		HMG_box	95..162	CDD:395407	23/67 (34%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	162..209		1/3 (33%)
		Required for chemotactic activity. /evidence=ECO:0000269\|PubMed:19811285	165..180		24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1641977at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.820