powered by:
Protein Alignment tHMG2 and Tox2
DIOPT Version :9
Sequence 1: | NP_001163689.1 |
Gene: | tHMG2 / 42651 |
FlyBaseID: | FBgn0038979 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017447281.1 |
Gene: | Tox2 / 311615 |
RGDID: | 735184 |
Length: | 561 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 37/71 - (52%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
|:||:||:.|:...| :..|:.::|..:..:||.....||.::.:|.|..::.....|..||.:.
Rat 292 PQKPVSAYALFFRDT-QAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKA 355
Fly 74 LEKWNA 79
|..:.|
Rat 356 LAAYRA 361
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tHMG2 | NP_001163689.1 |
HMGB-UBF_HMG-box |
9..75 |
CDD:238686 |
18/65 (28%) |
Tox2 | XP_017447281.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.