DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and SOX8

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_055402.2 Gene:SOX8 / 30812 HGNCID:11203 Length:446 Species:Homo sapiens


Alignment Length:68 Identity:21/68 - (30%)
Similarity:40/68 - (58%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ARP--KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAE 69
            |:|  |:||:|||:|..:..|| :..::|.....|:|...|::||.:::..|..:.|.|.:...:
Human    98 AKPHVKRPMNAFMVWAQAARRK-LADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQ 161

  Fly    70 YKE 72
            :|:
Human   162 HKK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 18/62 (29%)
SOX8NP_055402.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Sox_N 18..89 CDD:463586
Dimerization (DIM). /evidence=ECO:0000303|PubMed:31194875 58..100 1/1 (100%)
HMG-box_SoxE 101..175 CDD:438840 19/65 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..259 2/10 (20%)
Transactivation domain (TAM). /evidence=ECO:0000303|PubMed:31194875 224..298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..378
Transactivation domain (TAC). /evidence=ECO:0000303|PubMed:31194875 335..446
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 400..408
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..446
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.