DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Hmgb2

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_058883.1 Gene:Hmgb2 / 29395 RGDID:69291 Length:210 Species:Rattus norvegicus


Alignment Length:71 Identity:24/71 - (33%)
Similarity:42/71 - (59%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||:|.|||.|:. |..|..|::|||..|:.:.:.|.||||...:.:.|..:::.|:|...:|::.
  Rat    95 PKRPPSAFFLFC-SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKD 158

  Fly    74 LEKWNA 79
            :..:.|
  Rat   159 IAAYRA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 21/66 (32%)
Hmgb2NP_058883.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..102 4/6 (67%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 23/68 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210 1/3 (33%)
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.