DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Hmgb2

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_058883.1 Gene:Hmgb2 / 29395 RGDID:69291 Length:210 Species:Rattus norvegicus


Alignment Length:71 Identity:24/71 - (33%)
Similarity:42/71 - (59%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||:|.|||.|:. |..|..|::|||..|:.:.:.|.||||...:.:.|..:::.|:|...:|::.
  Rat    95 PKRPPSAFFLFC-SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKD 158

  Fly    74 LEKWNA 79
            :..:.|
  Rat   159 IAAYRA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 23/65 (35%)
Hmgb2NP_058883.1 HMG_box_2 6..78 CDD:401091
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..102 4/6 (67%)
HMG_box 95..162 CDD:395407 23/67 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210 1/3 (33%)
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.