powered by:
Protein Alignment tHMG2 and Tox3
DIOPT Version :9
Sequence 1: | NP_001163689.1 |
Gene: | tHMG2 / 42651 |
FlyBaseID: | FBgn0038979 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006255249.1 |
Gene: | Tox3 / 291908 |
RGDID: | 1311529 |
Length: | 579 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 22/71 - (30%) |
Similarity: | 39/71 - (54%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
|:||:||:.|:...| :..|:.::|:.:..|||.....||.::.:|.|.|::.....|..||.:.
Rat 254 PQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKA 317
Fly 74 LEKWNA 79
|..:.|
Rat 318 LAAYRA 323
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.