DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Tox3

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001386129.1 Gene:Tox3 / 291908 RGDID:1311529 Length:579 Species:Rattus norvegicus


Alignment Length:71 Identity:22/71 - (30%)
Similarity:39/71 - (54%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            |:||:||:.|:...| :..|:.::|:.:..|||.....||.::.:|.|.|::.....|..||.:.
  Rat   254 PQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKA 317

  Fly    74 LEKWNA 79
            |..:.|
  Rat   318 LAAYRA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 20/66 (30%)
Tox3NP_001386129.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..258 2/3 (67%)
HMG-box_TOX-like 255..324 CDD:438811 21/70 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 520..579
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.