DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Tox4

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_775446.2 Gene:Tox4 / 286990 RGDID:708449 Length:619 Species:Rattus norvegicus


Alignment Length:116 Identity:33/116 - (28%)
Similarity:58/116 - (50%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQ---ESAS----KA 66
            |:||:||:.|:...| :..|:.::|:.:..|||.....||.::.:|.|.|::   |:|.    ||
  Rat   223 PQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKA 286

  Fly    67 MAEYKEKLE--------KWNAFKEHQTESFPHIYEAPLSSRFSKTNQRPTL 109
            :|.||:..|        :.:...:.||.|.|.:..|..:|....:.:.|.|
  Rat   287 LAAYKDNQECQATVETVELDPVPQSQTPSPPPVTTADPASPAPASTESPAL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 24/72 (33%)
Tox4NP_775446.2 NHP6B 140..>306 CDD:227935 25/83 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..227 2/3 (67%)
Nuclear localization signal. /evidence=ECO:0000255 213..218
HMG-box 223..288 CDD:238037 21/65 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..335 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..458
PHA03160 <464..530 CDD:165431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.