DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Tox4

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_775446.2 Gene:Tox4 / 286990 RGDID:708449 Length:619 Species:Rattus norvegicus


Alignment Length:116 Identity:33/116 - (28%)
Similarity:58/116 - (50%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQ---ESAS----KA 66
            |:||:||:.|:...| :..|:.::|:.:..|||.....||.::.:|.|.|::   |:|.    ||
  Rat   223 PQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKA 286

  Fly    67 MAEYKEKLE--------KWNAFKEHQTESFPHIYEAPLSSRFSKTNQRPTL 109
            :|.||:..|        :.:...:.||.|.|.:..|..:|....:.:.|.|
  Rat   287 LAAYKDNQECQATVETVELDPVPQSQTPSPPPVTTADPASPAPASTESPAL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 24/81 (30%)
Tox4NP_775446.2 NHP6B 140..>306 CDD:227935 25/83 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..227 2/3 (67%)
Nuclear localization signal. /evidence=ECO:0000255 213..218
HMG-box_TOX-like 224..293 CDD:438811 23/69 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..335 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..458
Peptidase_S21 <464..530 CDD:330753
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.