DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and nhp6

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_593314.1 Gene:nhp6 / 2542878 PomBaseID:SPAC57A10.09c Length:108 Species:Schizosaccharomyces pombe


Alignment Length:78 Identity:20/78 - (25%)
Similarity:42/78 - (53%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||:.||||| :.:...|:.::.::||.:..::....|:.|:.:....:..::|.|    .:.||:
pombe    16 PKRNMSAFM-FFSIENREKMKTDNPDATFGQLGSLLGKRWKELTSTEREPYEEKA----RQDKER 75

  Fly    74 LEKWNAFKEHQTE 86
            .|:..  ||:.|:
pombe    76 YERER--KEYDTK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 16/65 (25%)
nhp6NP_593314.1 NHP6B <7..>108 CDD:227935 20/78 (26%)
HMGB-UBF_HMG-box 16..81 CDD:238686 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2031
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.