DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Ubtf

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001349473.1 Gene:Ubtf / 21429 MGIID:98512 Length:764 Species:Mus musculus


Alignment Length:108 Identity:30/108 - (27%)
Similarity:49/108 - (45%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAE-HPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKE 72
            |:||.:...||.  |..|.:..: .||.:.:||....|:.|..::|:.::.|...|.:...||:|
Mouse   196 PEKPKTPQQLWY--THEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEE 258

  Fly    73 -------KLEKWNAFKEHQTESFPHIYEAPLSSRFSKTNQRPT 108
                   |..:.|..:|..|:|.....|..|..:|   :.|||
Mouse   259 IMRDYIQKHPELNISEEGITKSTLTKAERQLKDKF---DGRPT 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 20/73 (27%)
UbtfNP_001349473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HMG_box 112..179 CDD:395407
HMGB-UBF_HMG-box 196..261 CDD:238686 19/66 (29%)
HMGB-UBF_HMG-box 299..358 CDD:238686 30/108 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..411
HMGB-UBF_HMG-box 407..470 CDD:238686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 456..487
HMG_box_5 479..562 CDD:373364
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 546..576
HMGB-UBF_HMG-box 569..631 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.